PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01970.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 148aa    MW: 16715.9 Da    PI: 4.9806
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01970.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.69.5e-122276559
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                             ++ +r+ +NRe+ArrsR +K++ ++ L+  v +L+++N +    ++  ++++ ++
  Rsa1.0_01970.1_g00004.1 22 RKRKRMLSNRESARRSRMKKQKLLDDLTAQVNQLKEQNNEIVTSVSITTQHYLTV 76
                             7889**********************************98777766666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.4E-101664No hitNo description
SMARTSM003381.1E-161882IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1052083IPR004827Basic-leucine zipper domain
PfamPF001701.6E-82163IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.58E-122275No hitNo description
CDDcd147024.90E-172373No hitNo description
PROSITE patternPS0003602540IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MEPSSSGTTS PSGSEESLME QRKRKRMLSN RESARRSRMK KQKLLDDLTA QVNQLKEQNN  60
EIVTSVSITT QHYLTVEAEN SVLRAQLHEL SHRLESLNDI IELLDSTNGI CPSLLTGPEP  120
DDFLVNQMNT NMFCMNQLLM ASSDALLY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12142RKRKRMLSNRESARRSRMKKQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895291e-116AC189529.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB092P05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013666762.11e-87PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A078H3Z31e-87A0A078H3Z3_BRANA; BnaA10g13430D protein
STRINGBra034639.1-P6e-87(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.13e-68G-box binding factor 6